Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503176

SET and MYND Domain Containing 2 (SMYD2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms smyd2, im:7146196, wu:fc02f02, zgc:110553, HSKM-B, KMT3C, ZMYND14, Zmynd14, 4930402C15, 1110020E07Rik, smyd2-a
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN503176
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SMYD2 antibody: synthetic peptide directed towards the middle region of human SMYD2
Sequence SMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPY ISEIKQEIES
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Chicken : 92%, Guinea pig : 92%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against SMYD2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SMYD2
Background The specific function of this protein remains unknown.SET domain-containing proteins, such as SMYD2, catalyze lysine methylation (Brown et al., 2006 [PubMed 16805913]).
Molecular Weight 50kDa
Gene ID 56950
NCBI Accession NP_064582, NM_020197
UniProt Q9NRG4
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SMYD2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Shibamoto, Ogino, Suzuki et al.: "Primary central nervous system lymphoma in Japan: changes in clinical features, treatment, and prognosis during 1985-2004." in: Neuro-oncology, Vol. 10, Issue 4, pp. 560-8, 2008 (PubMed).

Background publications Abu-Farha, Lambert, Al-Madhoun et al.: "The tale of two domains: proteomics and genomics analysis of SMYD2, a new histone methyltransferase." in: Molecular & cellular proteomics : MCP, Vol. 7, Issue 3, pp. 560-72, 2008 (PubMed).

Alternatives for antigen "SET and MYND Domain Containing 2 (SMYD2)", type "Antibodies"
Hosts (34), (3)
Reactivities (37), (24), (17), (12), (12), (12)
Applications (28), (14), (10), (3), (3), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (5), (3), (2), (1)
Beacon