WD Repeat and FYVE Domain Containing 3 (WDFY3) antibody

Antigen: WD Repeat and FYVE Domain Containing 3 (WDFY3)

Synonyms: ALFY, ZFYVE25, KIAA0993, MGC16461

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN503195

Additional Information

Alternative name: WDFY3

Gene ID: WDFY3

UniProt: Q8IZQ1

Immunogen: The immunogen for anti-WDFY3 antibody: synthetic peptide directed towards the middle region of human WDFY3

Sequence: LEVMVNLLHKYAALLKDPTQALNEQGDSRNNSSVEDQKHL ALLVMETLTV

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-WDFY3 antibody concentration is 1 mg/ml.

Description: WDFY3 is a protein which contains WD repeats and an FYVE domain. WDFY3 might target cytosolic protein aggregates for autophagic degradation.Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.This gene encodes a protein which contains WD repeats and an FYVE domain. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

Characteristics: Antigen Size: 795 amino acids

Molecular Weight: 90kDa

Application Details

Application Notes: WB Suggested Anti-WDFY3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Muscle.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-WDFY3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Muscle

Publications

Product: Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).