Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503196

Zinc Finger Protein 714 (ZNF714) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503196
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF714 antibody: synthetic peptide directed towards the N terminal of human ZNF714
Sequence NVMLENYKNLVFLAGIAVSKQDPITSLEQEKEPWNMKICE MVDESPAMCS
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against ZNF714. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF714
Background ZNF714 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Molecular Weight 64kDa
Gene ID 148206
NCBI Accession NP_872321, NM_182515
UniProt Q96N38
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF714 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Alternatives for antigen "Zinc Finger Protein 714 (ZNF714)", type "Antibodies"
Hosts (2)
Reactivities (2)
Applications (2), (1)
Epitopes (1)
Beacon