Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 714 (ZNF714) (N-Term) antibody

Details for Product No. ABIN503196
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
(1)
Reactivity
Human
(2)
Host
Rabbit
(2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503196
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF714
Sequence NVMLENYKNLVFLAGIAVSKQDPITSLEQEKEPWNMKICE MVDESPAMCS
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF714. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF714
Background ZNF714 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Molecular Weight 64 kDa
Gene ID 148206
NCBI Accession NM_182515, NP_872321
UniProt Q96N38
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 555 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 714 (ZNF714) (N-Term) antibody WB Suggested Anti-ZNF714 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Muscle
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503196
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top