Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

DDB1 and CUL4 Associated Factor 12 (DCAF12) antibody

Antigen

DDB1 and CUL4 Associated Factor 12 (DCAF12)

Synonyms CT102, TCC52, WDR40A, MGC1058, KIAA1892, DKFZp434O125, Wdr40a, AA420338, AI851081, 1500001L20Rik, 5830424K06Rik, wdr40a, wdr40b, MGC76023, dcaf12, MGC154031
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Dog (Canine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN503229
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name WDR40A
Gene ID WDR40A
UniProt Q5T6F0
Immunogen The immunogen for anti-WDR40A antibody: synthetic peptide directed towards the N terminal of human WDR40A
Sequence ARKVVSRKRKAPASPGAGSDAQGPQFGWDHSLHKRKRLPP VKRSLVYYLK
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-WDR40A antibody concentration is 1 mg/ml.
Description The function of WDR40A has not yet been determined.This gene was identified by isolating cDNA from a size-fractionated library derived from brain in an attempt to characterize genes encoding large proteins. The function of the protein encoded by this gene has not yet been determined.
Characteristics Antigen Size: 453 amino acids
Molecular Weight 50kDa

Application Details

Application Notes WB Suggested Anti-WDR40A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Barrios-Rodiles, Brown, Ozdamar et al.: "High-throughput mapping of a dynamic signaling network in mammalian cells." in: Science (New York, N.Y.), Vol. 307, Issue 5715, pp. 1621-5, 2005 (PubMed).

Alternatives

Alternatives for antigen "DDB1 and CUL4 Associated Factor 12 (DCAF12)", type "Antibodies"
Hosts Rabbit (24), Chicken (3)
Reactivities Human (25), Mouse (Murine) (21), Rat (Rattus) (21), Chicken (1), Cow (Bovine) (1), Dog (Canine) (1), Xenopus laevis (1)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (12), ELISA (9), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunocytochemistry (ICC) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes C-Term (2), Internal Region (1), N-Term (1)