Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Microtubule-Associated Protein 1 Light Chain 3 alpha (MAP1LC3A) antibody

Antigen

Microtubule-Associated Protein 1 Light Chain 3 alpha (MAP1LC3A)

Synonyms LC3, LC3A, MAP1ALC3, MAP1BLC3, LC3a, 1010001H21Rik, 4922501H04Rik, MGC105263, MGC69006, map1lc3a, MGC53333, zgc:77094, MAP1LC3A, MGC89867, MGC138125
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Zebrafish, Chicken, Xenopus laevis

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN503230
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name LC3A
Gene ID MAP1LC3A
UniProt Q9H492-2
Immunogen The immunogen for anti-MAP1LC3A antibody: synthetic peptide directed towards the N terminal of human MAP1LC3A
Sequence MKMRFFSSPCGKAAVDPADRCKEVQQIRDQHPSKIPVIIE RYKGEKQLPV
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-MAP1LC3A antibody concentration is 1 mg/ml.
Description MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. MAP1LC3A is one of the light chain subunits and can associate with either MAP1A or MAP1B.MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. The protein encoded by this gene is one of the light chain subunits and can associate with either MAP1A or MAP1B. Two transcript variants encoding different isoforms have been found for this gene.
Characteristics Antigen Size: 125 amino acids
Molecular Weight 14kDa

Application Details

Application Notes WB Suggested Anti-MAP1LC3A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Taylor, Kirkegaard: "Modification of cellular autophagy protein LC3 by poliovirus." in: Journal of virology, Vol. 81, Issue 22, pp. 12543-53, 2007 (PubMed).

Alternatives

Alternatives for antigen "Microtubule-Associated Protein 1 Light Chain 3 alpha (MAP1LC3A)", type "Antibodies"
Hosts Rabbit (46), Sheep (4), Goat (2), Mouse (2)
Reactivities Human (49), Mouse (Murine) (28), Rat (Rattus) (26), Cow (Bovine) (10), Dog (Canine) (3), Opossum (Didelphimorphia) (3), Cat (Feline) (1), Chicken (1), Fish (1), Monkey (1), Pig (Porcine) (1), Rabbit (1), Zebrafish (1), Zebrafish (Danio rerio) (1)
Applications Western Blotting (WB) (44), ELISA (23), Immunofluorescence (IF) (19), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (15), Immunohistochemistry (IHC) (10), Immunocytochemistry (ICC) (8), Immunoprecipitation (IP) (5), Dot Blot (DB) (2), Dot Blot (Dot) (2), Immunohistochemistry (Fixed) (IHC (fx)) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), PE,Cy5.5 (1)
Epitopes pSer12 (4), N-Term (3), AA 1-50 (2), AA 97-106 (1), Cleaved (1), Internal Region (1), pSer3 (1), pThr93 (1), pTyr182,pThr180 (1)