Synovial Sarcoma, X Breakpoint 7 (SSX7) (Middle Region) antibody

Details for Product No. ABIN503245
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
Middle Region
(2), (1), (1)
Reactivity
Human
(4)
Host
Rabbit
(4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(4)
Pubmed 1 reference available
Catalog no. ABIN503245
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human SSX7
Sequence IFPKIMPKKPAEEGNDSKGVPEASGSQNDGKHLCPPGKPS TSEKINKTSG
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against SSX7. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SSX7
Background SSX7 belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X,18) translocation characteristically found in all synovial sarcomas. This gene appears not to be involved in this type of chromosome translocation.The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X,18) translocation characteristically found in all synovial sarcomas. This gene appears not to be involved in this type of chromosome translocation.
Molecular Weight 21 kDa
Gene ID 280658
NCBI Accession NM_173358, NP_775494
UniProt Q7RTT5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 188 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Synovial Sarcoma, X Breakpoint 7 (SSX7) (Middle Region) antibody WB Suggested Anti-SSX7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Pancreas
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome...." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Hosts (4)
Reactivities (4)
Applications (4)
Epitopes (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top