Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503245

Synovial Sarcoma, X Breakpoint 7 (SSX7) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503245
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SSX7 antibody: synthetic peptide directed towards the middle region of human SSX7
Sequence IFPKIMPKKPAEEGNDSKGVPEASGSQNDGKHLCPPGKPS TSEKINKTSG
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against SSX7. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SSX7
Background SSX7 belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X,18) translocation characteristically found in all synovial sarcomas. This gene appears not to be involved in this type of chromosome translocation.The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X,18) translocation characteristically found in all synovial sarcomas. This gene appears not to be involved in this type of chromosome translocation.
Molecular Weight 21kDa
Gene ID 280658
NCBI Accession NP_775494, NM_173358
UniProt Q7RTT5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SSX7 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Alternatives for antigen "Synovial Sarcoma, X Breakpoint 7 (SSX7)", type "Antibodies"
Hosts (4)
Reactivities (4)
Applications (4)
Epitopes (2), (2), (1)
Beacon