Synovial Sarcoma, X Breakpoint 7 (SSX7) antibody

Antigen: Synovial Sarcoma, X Breakpoint 7 (SSX7)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN503245

Additional Information

Alternative name: SSX7

Gene ID: SSX7

UniProt: Q7RTT5

Immunogen: The immunogen for anti-SSX7 antibody: synthetic peptide directed towards the middle region of human SSX7

Sequence: IFPKIMPKKPAEEGNDSKGVPEASGSQNDGKHLCPPGKPS TSEKINKTSG

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SSX7 antibody concentration is 1 mg/ml.

Description: SSX7 belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X,18) translocation characteristically found in all synovial sarcomas. This gene appears not to be involved in this type of chromosome translocation.The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X,18) translocation characteristically found in all synovial sarcomas. This gene appears not to be involved in this type of chromosome translocation.

Characteristics: Antigen Size: 188 amino acids

Molecular Weight: 21kDa

Application Details

Application Notes: WB Suggested Anti-SSX7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Pancreas.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SSX7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Pancreas

Publications

Product: Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).