Chaperonin Containing TCP1, Subunit 7 (Eta) (CCT7) antibody

Antigen: Chaperonin Containing TCP1, Subunit 7 (Eta) (CCT7)

Synonyms: fb38h02, fc05g05, chunp6934, wu:fb38h02, wu:fc05g05, cct7, MGC80866, CCT7, Cct7, DKFZp469M1631, ccth, nip7-1, cct-eta, MGC108310, tcp-1-eta, CCT-ETA, MGC133783, TCP-1-ETA, Ccth, Nip7-1, MGC110985, TCP-1-eta, Cctz, AA408524, AL022769

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Chicken, Dog (Canine), Pig (Porcine), Rabbit, Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN503262

Additional Information

Alternative name: CCT7 / TCP1 eta

Gene ID: CCT7

UniProt: Q99832

Immunogen: The immunogen for anti-CCT7 antibody: synthetic peptide directed towards the middle region of human CCT7

Sequence: RAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGA YAKALEIIPR

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rabbit, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-CCT7 antibody concentration is 1 mg/ml.

Description: CCT7 is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. This gene encodes a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants encoding different isoforms have been found for this gene, but only two of them have been characterized to date.

Characteristics: Antigen Size: 543 amino acids

Molecular Weight: 60kDa

Synonyms: fb38h02, fc05g05, chunp6934, wu:fb38h02, wu:fc05g05, cct7, MGC80866, CCT7, Cct7, DKFZp469M1631, ccth, nip7-1, cct-eta, MGC108310, tcp-1-eta, CCT-ETA, MGC133783, TCP-1-ETA, Ccth, Nip7-1, MGC110985, TCP-1-eta, Cctz, AA408524, AL022769

Application Details

Application Notes: WB Suggested Anti-CCT7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-CCT7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate

Sample Type: HEK 293 (10ug)
Primary Dilution: 1:1000
Secondary Antibody: conjugated goat anti-rabbit
Secondary Dilution: 1:10,000
Image Submitted By: Amy Gray
Brigham Young University

Publications

Product: Guo, Han, Adam et al.: "Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress." in: Biochemical and biophysical research communications, Vol. 337, Issue 4, pp. 1308-18, 2005 (PubMed).