Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503321

Mitochondrial Ribosomal Protein L28 (MRPL28) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms p15, MAAT1, 1110015G04Rik, L28mt, MRP-L28, CG3782, Dmel\\CG3782, GB14554, MRPL28, maat1, wu:fa96b11, zgc:110013
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503321
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MRPL28 antibody: synthetic peptide directed towards the middle region of human MRPL28
Sequence EDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLL EEKDPVPLFK
Predicted Reactivity Guinea pig : 100%, Horse : 100%, Human : 100%, Rat : 100%, Chicken : 92%, Dog : 92%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against MRPL28. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MRPL28
Background Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
Molecular Weight 30kDa
Gene ID 10573
NCBI Accession NP_006419, NM_006428
UniProt Q13084
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MRPL28 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Martin, Han, Gordon et al.: "The sequence and analysis of duplication-rich human chromosome 16." in: Nature, Vol. 432, Issue 7020, pp. 988-94, 2004 (PubMed).

Alternatives for antigen "Mitochondrial Ribosomal Protein L28 (MRPL28)", type "Antibodies"
Hosts (20), (3), (1)
Reactivities (23), (15), (15), (12), (12)
Applications (15), (10), (7), (3), (3), (2), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2), (2), (1), (1)
Beacon