Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Mitochondrial Ribosomal Protein L28 (MRPL28) antibody

Antigen

Mitochondrial Ribosomal Protein L28 (MRPL28)
Synonyms p15, MAAT1, MGC8499, MRP-L28, DmelCG3782, CG3782, MRPL28, RPML28, MGC3314, FLJ44438, MGC24095, MGC8184, 1110015G04Rik, GB14554, mrpl28, MGC84279, MGC126950, maat1, wu:fa96b11, zgc:110013
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Human, Mouse (Murine), Rat (Rattus)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN503321
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Mitochondrial Ribosomal Protein L28 (MRPL28) antibody

Additional Information
Application Details Publications Images Alternatives back to top

Alternative name MRPL28
Gene ID MRPL28
UniProt Q13084
Immunogen The immunogen for anti-MRPL28 antibody: synthetic peptide directed towards the middle region of human MRPL28
Sequence EDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLL EEKDPVPLFK
Cross-Reactivity Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-MRPL28 antibody concentration is 1 mg/ml.
Description Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
Characteristics Antigen Size: 256 amino acids
Molecular Weight 30kDa

Application Details
Publications Images Alternatives back to top

Application Notes WB Suggested Anti-MRPL28 Antibody Titration: 0.2-1 ug/ml
Positive Control: PANC1 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only

Publications
Application Details Images Alternatives back to top

Product Martin, Han, Gordon et al.: "The sequence and analysis of duplication-rich human chromosome 16." in: Nature, Vol. 432, Issue 7020, pp. 988-94, 2004 (PubMed).

Alternatives
Application Details Publications Images back to top

Alternatives for antigen "Mitochondrial Ribosomal Protein L28 (MRPL28)", type "Antibodies"
Hosts Rabbit (26), Mouse (1)
Reactivities Human (26), Rat (Rattus) (23), Mouse (Murine) (22), Chicken (19), Cow (Bovine) (19), Cat (Feline) (1), Dog (Canine) (1)
Applications Immunofluorescence (IF) (17), Western Blotting (WB) (12), ELISA (8), Immunoprecipitation (IP) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunohistochemistry (IHC) (2), Flow Cytometry (FACS) (1), Immunocytochemistry (ICC) (1), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (Frozen Sections) (IHC (fro)) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes Internal Region (1)