Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503369

Chromosome 7 Open Reading Frame 31 (C7orf31) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C7orf31
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503369
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C7orf31 antibody: synthetic peptide directed towards the N terminal of human C7orf31
Sequence EVIHGRPYCCRELEGADILSNTFYSNELHNPLQTVTRPTA SEDRYQELRE
Predicted Reactivity Human : 100%, Rabbit : 85%
Characteristics This is a rabbit polyclonal antibody against C7orf31. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C7orf31
Background The exact function of C7orf31 remains unknown.
Molecular Weight 68kDa
Gene ID 136895
NCBI Accession NP_620166, NM_138811
UniProt Q8N865
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C7orf31 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hillier, Fulton, Fulton et al.: "The DNA sequence of human chromosome 7." in: Nature, Vol. 424, Issue 6945, pp. 157-64, 2003 (PubMed).

Alternatives for antigen "Chromosome 7 Open Reading Frame 31 (C7orf31)", type "Antibodies"
Hosts (3)
Reactivities (2)
Applications (3), (1)
Epitopes (1), (1)
Beacon