Chromosome 7 Open Reading Frame 31 (C7orf31) (N-Term) antibody

Details for Product No. ABIN503369
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms C7orf31
Epitope
N-Term
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(2)
Host
Rabbit
(2), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(3), (1)
Pubmed 1 reference available
Catalog no. ABIN503369
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human C7orf31
Sequence EVIHGRPYCCRELEGADILSNTFYSNELHNPLQTVTRPTA SEDRYQELRE
Predicted Reactivity Human : 100 %, Rabbit : 80 %
Characteristics This is a rabbit polyclonal antibody against C7orf31. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C7orf31
Background The exact function of C7orf31 remains unknown.
Molecular Weight 68 kDa
Gene ID 136895
NCBI Accession NM_138811, NP_620166
UniProt Q8N865
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 590 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 7 Open Reading Frame 31 (C7orf31) (N-Term) antibody WB Suggested Anti-C7orf31 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Background publications Hillier, Fulton, Fulton et al.: "The DNA sequence of human chromosome 7." in: Nature, Vol. 424, Issue 6945, pp. 157-64, 2003 (PubMed).

Hosts (2), (1)
Reactivities (2)
Applications (3), (1)
Epitopes (1)
back to top