Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Homeodomain Interacting Protein Kinase 4 (HIPK4) antibody

Antigen

Homeodomain Interacting Protein Kinase 4 (HIPK4)

Synonyms FLJ32818, Gm162
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN503376
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name HIPK4
Gene ID HIPK4
UniProt Q8NE63
Immunogen The immunogen for anti-HIPK4 antibody: synthetic peptide directed towards the middle region of human HIPK4
Sequence AEEKEAAGMGSVAGSSPFFREEKAPGMQRAIDQLDDLSLQ EAGHGLWGET
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-HIPK4 antibody concentration is 1 mg/ml.
Description HIPK4 is a protein kinase that phosphorylates human TP53 at Ser-9, and thus induces TP53 repression of BIRC5 promoter. It may act as a corepressor of transcription factors.
Characteristics Antigen Size: 616 amino acids
Molecular Weight 69kDa

Application Details

Application Notes WB Suggested Anti-HIPK4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Cell Cycle, Transcription Factors, Apoptosis/Necrosis
Restrictions For Research Use only

Publications

Product Arai, Matsushita, Du et al.: "Novel homeodomain-interacting protein kinase family member, HIPK4, phosphorylates human p53 at serine 9." in: FEBS letters, Vol. 581, Issue 29, pp. 5649-57, 2007 (PubMed).

Alternatives

Alternatives for antigen "Homeodomain Interacting Protein Kinase 4 (HIPK4)", type "Antibodies"
Hosts Rabbit (30), Mouse (1)
Reactivities Human (13), Mouse (Murine) (2), Rat (Rattus) (1)
Applications Immunofluorescence (IF) (16), Western Blotting (WB) (15), ELISA (14), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Dot Blot (DB) (1), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (4), N-Term (2), Internal Region (1)