Tektin 4 (TEKT4) antibody

Antigen: Tektin 4 (TEKT4)

Synonyms: MGC144759, MGC144760, 1700010L19Rik, MGC27019, Tek4, Tektin4, RGD1308075, MGC134304, MGC162848

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine)

Application: Western Blotting (WB)

Catalog no.: ABIN503377

Additional Information

Alternative name: Tektin-4 (TEKT4)

Gene ID: TEKT4

UniProt: Q8WW24

Immunogen: The immunogen for anti-TEKT4 antibody: synthetic peptide directed towards the N terminal of human TEKT4

Sequence: LATETQALAQRTQQDSTRTVGERLQDTHSWKSELQREMEA LAAETNLLLA

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TEKT4 antibody concentration is 1 mg/ml.

Description: TEKT4 belongs to the tektin family.TEKT4 is a structural component of ciliary and flagellar microtubules. It forms filamentous polymers in the walls of ciliary and flagellar microtubules.

Characteristics: Antigen Size: 435 amino acids

Molecular Weight: 51kDa

Application Details

Application Notes: WB Suggested Anti-TEKT4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TEKT4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

Publications

Product: Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).