Dual Specificity Phosphatase 10 (DUSP10) antibody

Antigen: Dual Specificity Phosphatase 10 (DUSP10)

Synonyms: MKP5, MKP-5, AI158871, 2610306G15Rik, DUSP10

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN503381

Additional Information

Alternative name: DUSP10 / MKP5

Gene ID: DUSP10

UniProt: D3DTB4

Immunogen: The immunogen for anti-DUSP10 antibody: synthetic peptide directed towards the N terminal of human DUSP10

Sequence: MQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQN LRQYFEEAFE

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-DUSP10 antibody concentration is 1 mg/ml.

Description: Dual specificity protein phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the MAPK superfamily (MAPK/ERK, SAPK/JNK, p38), which is associat

Characteristics: Antigen Size: 140 amino acids

Molecular Weight: 16kDa

Application Details

Application Notes: WB Suggested Anti-DUSP10 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: THP-1 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-DUSP10 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: THP-1 cell lysate

Publications

Product: Teng, Huang, Meng: "Several dual specificity phosphatases coordinate to control the magnitude and duration of JNK activation in signaling response to oxidative stress." in: The Journal of biological chemistry, Vol. 282, Issue 39, pp. 28395-407, 2007 (PubMed).