WAP Four-Disulfide Core Domain 5 (WFDC5) (N-Term) antibody

Details for Product No. ABIN503392
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PRG5, WAP1, dJ211D12.5, Prg5, Wap1, BC019734
Epitope
N-Term
(1), (1), (1), (1)
Reactivity
Cow (Bovine), Human
(18), (3)
Host
Rabbit
(18), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(12), (10), (9), (6), (4), (2), (2), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN503392
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human WFDC5
Sequence MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGP CLLSVPDQCV
Predicted Reactivity Human : 100 %, Pig : 80 %, Guinea pig : 80 %, Bovine : 70 %
Characteristics This is a rabbit polyclonal antibody against WFDC5. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name WFDC5
Background WFDC5 is a putative acid-stable proteinase inhibitor.This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. Most WFDC proteins contain only one WFDC domain, and this encoded protein contains two WFDC domains. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster.
Molecular Weight 11 kDa
Gene ID 149708
NCBI Accession NM_145652, NP_663627
UniProt Q8TCV5
Research Area Cancer, Extracellular Matrix
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 123 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-WAP Four-Disulfide Core Domain 5 (WFDC5) (N-Term) antibody WB Suggested Anti-WFDC5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain
Background publications Mukhopadhyay, Rosen: "The C-terminal domain of the nuclear factor I-B2 isoform is glycosylated and transactivates the WAP gene in the JEG-3 cells." in: Biochemical and biophysical research communications, Vol. 358, Issue 3, pp. 770-6, 2007 (PubMed).

Hosts (18), (4)
Reactivities (18), (3)
Applications (12), (10), (9), (6), (4), (2), (2), (1), (1), (1)
Conjugates (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top