Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503392

WAP Four-Disulfide Core Domain 5 (WFDC5) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PRG5, WAP1, dJ211D12.5, Prg5, Wap1, BC019734
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503392
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-WFDC5 antibody: synthetic peptide directed towards the N terminal of human WFDC5
Sequence MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGP CLLSVPDQCV
Predicted Reactivity Human : 100%, Pig : 85%, Guinea pig : 84%, Bovine : 78%
Characteristics This is a rabbit polyclonal antibody against WFDC5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name WFDC5
Background WFDC5 is a putative acid-stable proteinase inhibitor.This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. Most WFDC proteins contain only one WFDC domain, and this encoded protein contains two WFDC domains. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster.
Molecular Weight 11kDa
Gene ID 149708
NCBI Accession NP_663627, NM_145652
UniProt Q8TCV5
Research Area Cancer, Extracellular Matrix
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-WFDC5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Mukhopadhyay, Rosen: "The C-terminal domain of the nuclear factor I-B2 isoform is glycosylated and transactivates the WAP gene in the JEG-3 cells." in: Biochemical and biophysical research communications, Vol. 358, Issue 3, pp. 770-6, 2007 (PubMed).

Alternatives for antigen "WAP Four-Disulfide Core Domain 5 (WFDC5)", type "Antibodies"
Hosts (14), (3)
Reactivities (16)
Applications (10), (7), (5), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1), (1)
Beacon