Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Family with Sequence Similarity 154, Member A (FAM154A) antibody

Antigen

Family with Sequence Similarity 154, Member A (FAM154A)

Synonyms RP23-102G9.3, 4930500O09Rik, C9orf138, FLJ35283, MGC35182
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN503449
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name FAM154A
Gene ID C9orf138
UniProt Q8IYX7
Immunogen The immunogen for anti-C9orf138 antibody: synthetic peptide directed towards the N terminal of human C9orf138
Sequence SEYTENYPFYHSYLPRESFKPRREYQKGSIPMEGLTTSRR DFGPHKVAPV
Cross-Reactivity Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-C9orf138 antibody concentration is 1 mg/ml.
Description The specific function of the protein remains unknown.
Characteristics Antigen Size: 474 amino acids
Molecular Weight 54kDa

Application Details

Application Notes WB Suggested Anti-C9orf138 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: OVCAR-3 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Humphray, Oliver, Hunt et al.: "DNA sequence and analysis of human chromosome 9." in: Nature, Vol. 429, Issue 6990, pp. 369-74, 2004 (PubMed).

Alternatives

Alternatives for antigen "Family with Sequence Similarity 154, Member A (FAM154A)", type "Antibodies"
Hosts Rabbit (19)
Reactivities Human (1)
Applications Immunofluorescence (IF) (14), Western Blotting (WB) (4), ELISA (2), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes N-Term (1)