Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503453

RAB39B, Member RAS Oncogene Family (RAB39B) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MRX72, 6330580M05Rik, zgc:153068, RAB39B, LOC100221662
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rabbit, Mouse (Murine), Zebrafish (Danio rerio), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503453
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RAB39B antibody: synthetic peptide directed towards the N terminal of human RAB39B
Sequence MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPT VGVDFFSRLV
Predicted Reactivity Mouse : 100%, Rabbit : 100%, Zebrafish : 100%, Dog : 92%
Characteristics This is a rabbit polyclonal antibody against RAB39B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RAB39B
Background RAB39B may be involved in vesicular trafficking.This gene encodes a member of the Rab family of proteins. Rab proteins are small GTPases that are involved in vesicular trafficking.
Molecular Weight 24kDa
Gene ID 116442
NCBI Accession NP_741995, NM_171998
UniProt Q96DA2
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RAB39B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "RAB39B, Member RAS Oncogene Family (RAB39B)", type "Antibodies"
Hosts (10), (3)
Reactivities (12), (5), (2)
Applications (13), (4), (3), (2), (1)
Epitopes (4), (4), (2), (1)
Beacon