RAB39B, Member RAS Oncogene Family (RAB39B) antibody

Antigen: RAB39B, Member RAS Oncogene Family (RAB39B)

Synonyms: 6330580M05Rik, RAB39B, MGC139619, MGC165464, MGC153068, zgc:153068, LOC100221662

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Zebrafish, Rabbit

Application: Western Blotting (WB)

Catalog no.: ABIN503453

Additional Information

Alternative name: RAB39B

Gene ID: RAB39B

UniProt: Q96DA2

Immunogen: The immunogen for anti-RAB39B antibody: synthetic peptide directed towards the N terminal of human RAB39B

Sequence: MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPT VGVDFFSRLV

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rabbit

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-RAB39B antibody concentration is 1 mg/ml.

Description: RAB39B may be involved in vesicular trafficking.This gene encodes a member of the Rab family of proteins. Rab proteins are small GTPases that are involved in vesicular trafficking.

Characteristics: Antigen Size: 213 amino acids

Molecular Weight: 24kDa

Application Details

Application Notes: WB Suggested Anti-RAB39B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Stomach.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling

Restrictions: For Research Use only

Images

WB Suggested Anti-RAB39B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Stomach

Publications

Product: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).