Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503470

Abhydrolase Domain Containing 15 (ABHD15) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1300007F04Rik, RGD1304598
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503470
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ABHD15 antibody: synthetic peptide directed towards the N terminal of human LOC116236
Sequence QTLCHFVLPVAPGPELAREYLQLADDGLVALDWVVGPCVR GRRITSAGGL
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Mouse : 100%, Pig : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against LOC116236. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ABHD15
Background The specific function of this protein remains unknown.
Molecular Weight 52kDa
Gene ID 116236
NCBI Accession NP_937790, NM_198147
UniProt Q6UXT9
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ABHD15 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Alternatives for antigen "Abhydrolase Domain Containing 15 (ABHD15)", type "Antibodies"
Hosts (6)
Reactivities (6), (4), (2), (2)
Applications (6), (2)
Epitopes (2), (1), (1)
Beacon