Sideroflexin 4 (SFXN4) antibody

Antigen: Sideroflexin 4 (SFXN4)

Synonyms: BCRM1, MGC107253, MGC127289, MGC153199, im:7151335, zgc:153199, si:ch211-117n7.3

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine)

Application: Western Blotting (WB)

Catalog no.: ABIN503482

Additional Information

Alternative name: Sideroflexin-4 (SFXN4)

Gene ID: SFXN4

UniProt: Q6P4A7

Immunogen: The immunogen for anti-SFXN4 antibody: synthetic peptide directed towards the C terminal of human SFXN4

Sequence: SCTVLAMGLMVPFSFSIFPQIGQIQYCSLEEKIQSPTEET EIFYHRGV

Cross-Reactivity: Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SFXN4 antibody concentration is 1 mg/ml.

Description: SFXN4 is a multi-pass membrane protein. It belongs to the sideroflexin family. SFXN4 is a potential iron transporter.

Characteristics: Antigen Size: 337 amino acids

Molecular Weight: 38kDa

Application Details

Application Notes: WB Suggested Anti-SFXN4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SFXN4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate

Publications

Product: Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).