Adaptor-Related Protein Complex 2, beta 1 Subunit (AP2B1) antibody
| Antigen | Adaptor-Related Protein Complex 2, beta 1 Subunit (AP2B1) |
| Synonyms |
ADTB2, AP105B, CLAPB1, AP2-BETA, DKFZp781K0743, AP-2beta, AP-beta1, BAD1, bap, beta1/2, cg12532, DmelCG12532, AI788979, 1300012O03Rik, AP2B1, fa16e07, zgc:55659, wu:fa16c06, wu:fa16e07, wu:fc18c08, MG ...
show more
|
| Clonality | Polyclonal |
| Host |
Alternatives Rabbit |
| Reactivity |
Alternatives Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish, Chicken, Dog (Canine) |
| Conjugate |
Alternatives Un-conjugated |
| Application |
Alternatives Western Blotting (WB) |
![]() |
1 reference available |
| Catalog no. | ABIN503488 |
| Quantity | 50 µg (Variants) |
| Price | 317.90 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 2 to 3 Business Days |
Additional Information
| Alternative name | AP2 complex subunit beta-1 |
| Gene ID | AP2B1 |
| UniProt | P63010-2 |
| Immunogen | The immunogen for anti-AP2B1 antibody: synthetic peptide directed towards the middle region of human AP2B1 |
| Sequence | DMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVS QYIYQVYDSI |
| Cross-Reactivity | Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus) |
| Format | Lyophilized |
| Reconstitution | Add 50 µl of distilled water. Final anti-AP2B1 antibody concentration is 1 mg/ml. |
| Description | AP2B1 is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. AP2B1 is found on the cytoplasmic face of coated vesicles in the plasma membrane.The protein encoded by this gene is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. The encoded protein is found on the cytoplasmic face of coated vesicles in the plasma membrane. Two transcript variants encoding different isoforms have been found for this gene. |
| Characteristics | Antigen Size: 951 amino acids |
| Molecular Weight | 105kDa |
| Synonyms | ADTB2, AP105B, CLAPB1, AP2-BETA, DKFZp781K0743, AP-2beta, AP-beta1, BAD1, bap, beta1/2, cg12532, DmelCG12532, AI788979, 1300012O03Rik, AP2B1, fa16e07, zgc:55659, wu:fa16c06, wu:fa16e07, wu:fc18c08, MGC53044, MGC75877, DKFZp469O1619 |
Application Details
| Application Notes |
WB Suggested Anti-AP2B1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: OVCAR-3 cell lysate. |
| Purification | Affinity Purified |
| Buffer | PBS |
| Storage (Long Term) | For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Storage (Short Term) | Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. |
| Restrictions | For Research Use only |
Images
|
WB Suggested Anti-AP2B1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: OVCAR-3 cell lysate |
Publications
| Product |
Schmid, Ford, Burtey et al.: "Role of the AP2 beta-appendage hub in recruiting partners for clathrin-coated vesicle assembly." in: PLoS biology, Vol. 4, Issue 9, pp. e262, 2006 (PubMed).
|
Alternatives
Alternatives for antigen "Adaptor-Related Protein Complex 2, beta 1 Subunit (AP2B1)", type "Antibodies"
| Hosts | Rabbit (17), Mouse (1) |
| Reactivities | Human (15), Mouse (Murine) (6), Rat (Rattus) (6), Chicken (3), Cow (Bovine) (3), Dog (Canine) (3), Xenopus laevis (2), Zebrafish (2), Cat (Feline) (1) |
| Applications | Western Blotting (WB) (18), ELISA (11), Immunohistochemistry (IHC) (5), Immunofluorescence (IF) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1), Immunoprecipitation (IP) (1) |
| Conjugates | Biotin (1), FITC (1), HRP (1) |
| Epitopes | Subunit sigma (4), Internal Region (2), C-Term (1), Center (1) |




Alternatives