Adaptor-Related Protein Complex 2, beta 1 Subunit (AP2B1) antibody

Antigen: Adaptor-Related Protein Complex 2, beta 1 Subunit (AP2B1)

Synonyms: ADTB2, AP105B, CLAPB1, AP2-BETA, DKFZp781K0743, AP-2beta, AP-beta1, BAD1, bap, beta1/2, cg12532, DmelCG12532, AI788979, 1300012O03Rik, AP2B1, fa16e07, zgc:55659, wu:fa16c06, wu:fa16e07, wu:fc18c08, MGC53044, MGC75877, DKFZp469O1619

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish, Chicken, Dog (Canine)

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN503488

Additional Information

Alternative name: AP2 complex subunit beta-1

Gene ID: AP2B1

UniProt: P63010-2

Immunogen: The immunogen for anti-AP2B1 antibody: synthetic peptide directed towards the middle region of human AP2B1

Sequence: DMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVS QYIYQVYDSI

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-AP2B1 antibody concentration is 1 mg/ml.

Description: AP2B1 is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. AP2B1 is found on the cytoplasmic face of coated vesicles in the plasma membrane.The protein encoded by this gene is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. The encoded protein is found on the cytoplasmic face of coated vesicles in the plasma membrane. Two transcript variants encoding different isoforms have been found for this gene.

Characteristics: Antigen Size: 951 amino acids

Molecular Weight: 105kDa

Synonyms: ADTB2, AP105B, CLAPB1, AP2-BETA, DKFZp781K0743, AP-2beta, AP-beta1, BAD1, bap, beta1/2, cg12532, DmelCG12532, AI788979, 1300012O03Rik, AP2B1, fa16e07, zgc:55659, wu:fa16c06, wu:fa16e07, wu:fc18c08, MGC53044, MGC75877, DKFZp469O1619

Application Details

Application Notes: WB Suggested Anti-AP2B1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: OVCAR-3 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-AP2B1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: OVCAR-3 cell lysate

Publications

Product: Schmid, Ford, Burtey et al.: "Role of the AP2 beta-appendage hub in recruiting partners for clathrin-coated vesicle assembly." in: PLoS biology, Vol. 4, Issue 9, pp. e262, 2006 (PubMed).