Sperm Associated Antigen 6 (SPAG6) antibody

Antigen: Sperm Associated Antigen 6 (SPAG6)

Synonyms: pf16, MGC26276, Repro-SA-1, DKFZp434I153, Spag6, RGD1310892, zgc:91805, SPAG6, MGC133832, repro-sa-1, MGC130870, DKFZp459D035

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Zebrafish, Xenopus laevis, Dog (Canine), Chicken, Pig (Porcine)

Application: Western Blotting (WB)

Catalog no.: ABIN503491

Additional Information

Alternative name: SPAG6 / PF16

Gene ID: SPAG6

UniProt: O75602

Immunogen: The immunogen for anti-SPAG6 antibody: synthetic peptide directed towards the middle region of human SPAG6

Sequence: HVVGQFSKVLPHDSKARRLFVTSGGLKKVQEIKAEPGSLL QEYINSINSC

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SPAG6 antibody concentration is 1 mg/ml.

Description: SPAG6 is important for structural integrity of the central apparatus in the sperm tail and for flagellar motility.The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. The protein expressed by this gene is recognized by anti-sperm antibodies from an infertile man. This protein localizes to the tail of permeabilized human sperm and contains eight contiguous armadillo repeats, a motif known to mediate protein-protein interactions. Studies in mice suggest that this protein is involved in sperm flagellar motility and maintenance of the structural integrity of mature sperm. Alternatively spliced variants that encode different protein isoforms have been described but the full-length sequences of only two have been determined.

Characteristics: Antigen Size: 509 amino acids

Molecular Weight: 56kDa

Application Details

Application Notes: WB Suggested Anti-SPAG6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HT1080 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SPAG6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HT1080 cell lysate

Publications

Product: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).