Kelch-Like 35 (Drosophila) (KLHL35) antibody

Antigen: Kelch-Like 35 (Drosophila) (KLHL35)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN503530

Additional Information

Alternative name: FLJ33790

Gene ID: FLJ33790

Immunogen: The immunogen for anti-FLJ33790 antibody: synthetic peptide directed towards the N terminal of human FLJ33790

Sequence: RPRRFMDLAEVIVVIGGCDRKGLLKLPFADAYHPESQRWT PLPSLPGYTR

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-FLJ33790 antibody concentration is 1 mg/ml.

Description: The specific functin of this protein remains unknown.

Characteristics: Antigen Size: 363 amino acids

Molecular Weight: 40kDa

Application Details

Application Notes: WB Suggested Anti-FLJ33790 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human kidney.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-FLJ33790 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human kidney

Publications

Product: Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).