FK506 Binding Protein 5 (FKBP5) (C-Term) antibody

Details for Product No. ABIN503556
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AIG6, FKBP51, FKBP54, P54, PPIase, Ptg-10, D17Ertd592e, Dit1, FKBP-5, zgc:64082, wu:fc31g11, wu:fl87b03, si:zc263a23.8, FKBP5
Epitope
C-Term
(6), (2), (2), (2), (1), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Pig (Porcine), Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
(45), (23), (20), (17), (12), (12), (5), (4)
Host
Rabbit
(34), (16), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(4), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(38), (22), (11), (10), (9), (7), (6), (3), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN503556
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human FKBP5
Sequence CYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMN EFESAKGDFE
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against FKBP5. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FKBP5
Background FKBP5 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. It is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. This gene has been found to have multiple polyadenylation sites.
Molecular Weight 51 kDa
Gene ID 2289
NCBI Accession NM_004117, NP_004108
UniProt Q13451
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 457 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-FK506 Binding Protein 5 (FKBP5) (C-Term) antibody WB Suggested Anti-FKBP5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
anti-FK506 Binding Protein 5 (FKBP5) (C-Term) antibody (2) anti-FK506 Binding Protein 5 (FKBP5) (C-Term) antibody (Image 2)
Background publications Lekman, Laje, Charney et al.: "The FKBP5-gene in depression and treatment response--an association study in the Sequenced Treatment Alternatives to Relieve Depression (STAR*D) Cohort." in: Biological psychiatry, Vol. 63, Issue 12, pp. 1103-10, 2008 (PubMed).

Hosts (34), (16), (1)
Reactivities (45), (23), (20), (17), (12), (12), (5), (4)
Applications (38), (22), (11), (10), (9), (7), (6), (3), (3), (1)
Conjugates (4), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (2), (2), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top