Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503556

FK506 Binding Protein 5 (FKBP5) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AIG6, FKBP51, FKBP54, P54, PPIase, Ptg-10, D17Ertd592e, Dit1, FKBP-5, zgc:64082, wu:fc31g11, wu:fl87b03, si:zc263a23.8, FKBP5
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Pig (Porcine), Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN503556
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FKBP5 antibody: synthetic peptide directed towards the C terminal of human FKBP5
Sequence CYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMN EFESAKGDFE
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 78%
Characteristics This is a rabbit polyclonal antibody against FKBP5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FKBP5
Background FKBP5 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. It is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. This gene has been found to have multiple polyadenylation sites.
Molecular Weight 51kDa
Gene ID 2289
NCBI Accession NP_004108, NM_004117
UniProt Q13451
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FKBP5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lekman, Laje, Charney et al.: "The FKBP5-gene in depression and treatment response--an association study in the Sequenced Treatment Alternatives to Relieve Depression (STAR*D) Cohort." in: Biological psychiatry, Vol. 63, Issue 12, pp. 1103-10, 2008 (PubMed).

Alternatives for antigen "FK506 Binding Protein 5 (FKBP5)", type "Antibodies"
Hosts (29), (16), (1)
Reactivities (40), (24), (20), (19), (13), (12), (6), (6), (1), (1)
Applications (35), (17), (10), (10), (6), (6), (3), (3), (2), (2)
Conjugates (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (2), (2), (1), (1), (1), (1), (1)
Beacon