Pyrroline-5-Carboxylate Reductase Family, Member 2 (PYCR2) antibody

Antigen: Pyrroline-5-Carboxylate Reductase Family, Member 2 (PYCR2)

Synonyms: P5CR2, FLJ54750, p5c, p5cr, pro3, pycr, pig45, pp222, pycr2, arcl2b, DKFZp468O245

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish, Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN503605

Additional Information

Alternative name: PYCR2

Gene ID: PYCR2

UniProt: Q96C36

Immunogen: The immunogen for anti-PYCR2 antibody: synthetic peptide directed towards the middle region of human PYCR2

Sequence: LDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINA VEASCIRTRE

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-PYCR2 antibody concentration is 1 mg/ml.

Description: PYCR2 belongs to the pyrroline-5-carboxylate reductase family. The function of the PYCR2 protein is not known.

Characteristics: Antigen Size: 320 amino acids

Molecular Weight: 34kDa

Application Details

Application Notes: WB Suggested Anti-PYCR2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-PYCR2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate

anti-Pyrroline-5-Carboxylate Reductase Family, Member 2 (PYCR2) antibody (Image 2)

Publications

Product: Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).