Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503616

Methyltransferase Like 5 (METTL5) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HSPC133, 2810410A08Rik, RGD1566062, im:7137598, zgc:103655
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503616
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-METTL5 antibody: synthetic peptide directed towards the N terminal of human METTL5
Sequence KKVRLKELESRLQQVDGFEKPKLLLEQYPTRPHIAACMLY TIHNTYDDIE
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 92%, Rabbit : 92%, Rat : 92%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against METTL5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name METTL5
Background METTL5 is a probable methyltransferase.
Molecular Weight 24kDa
Gene ID 29081
NCBI Accession NP_054887, NM_014168
UniProt Q9NRN9
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-METTL5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Alternatives for antigen "Methyltransferase Like 5 (METTL5)", type "Antibodies"
Hosts (7), (1)
Reactivities (6), (3), (2)
Applications (8), (4), (2), (2), (1)
Epitopes (3), (1)
Beacon