METTL5 antibody (N-Term)

Catalog No. ABIN631925

Product Details anti-METTL5 Antibody

Target: METTL5 (Methyltransferase Like 5 (METTL5))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This METTL5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: METTL5 antibody was raised against the N terminal of METTL5

Purification: Affinity purified

Immunogen: METTL5 antibody was raised using the N terminal of METTL5 corresponding to a region with amino acids KKVRLKELESRLQQVDGFEKPKLLLEQYPTRPHIAACMLYTIHNTYDDIE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

METTL5 Blocking Peptide, catalog no. 33R-4497, is also available for use as a blocking control in assays to test for specificity of this METTL5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for METTL5

Target: METTL5 (Methyltransferase Like 5 (METTL5))

Alternative Name: METTL5 (METTL5 Products)

Synonyms: im:7137598 antibody, zgc:103655 antibody, HSPC133 antibody, 2810410A08Rik antibody, RGD1566062 antibody, methyltransferase like 5 antibody, mettl5 antibody, METTL5 antibody, Mettl5 antibody

Background: METTL5 is a probable methyltransferase.

Molecular Weight: 24 kDa (MW of target protein)