Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503618

BRISC and BRCA1 A Complex Member 1 (BABAM1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C19orf62, MERIT40, NBA1, 5430437P03Rik, Merit40, c19orf62, merit40, nba1, C7H19orf62, zgc:100909
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503618
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C19orf62 antibody: synthetic peptide directed towards the N terminal of human C19orf62
Sequence DRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQV PPPAPEVQIR
Predicted Reactivity Dog :100%,   Mouse :100%,   Sumatran orangutan :100%,   Human :100%,   White-tufted-ear marmoset :92%,   Bovine :92%,   Western clawed frog :92%,   Rat :92%,   African clawed frog :92%,  
Characteristics This is a rabbit polyclonal antibody against C19orf62. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C19orf62
Background The exact function of C19orf62 remains unknown.
Molecular Weight 36kDa
Gene ID 29086
NCBI Accession NP_054892, NM_014173
UniProt Q9NWV8
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C19orf62 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "BRISC and BRCA1 A Complex Member 1 (BABAM1)", type "Antibodies"
Hosts (10), (1), (1)
Reactivities (11)
Applications (11), (6), (4), (3), (1), (1), (1), (1)
Epitopes (4), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Beacon