Did you know that you can buy products from over 140 different suppliers from us?

BRISC and BRCA1 A Complex Member 1 (BABAM1) (N-Term) antibody

Details for Product No. ABIN503618
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms merit40, nba1, zgc:100909, c19orf62, C19orf62, MERIT40, NBA1, C7H19orf62, 5430437P03Rik, Merit40
Epitope
N-Term
(9), (7), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human
(19)
Host
Rabbit
(17), (2), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(17), (9), (7), (6), (4), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503618
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human C19orf62
Sequence DRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQV PPPAPEVQIR
Predicted Reactivity Dog :100 %,   Mouse :100 %,   Sumatran orangutan :100 %,   Human :100 %,   White-tufted-ear marmoset :90 %,   Bovine :90 %,   Western clawed frog :90 %,   Rat :90 %,   African clawed frog :90 %,  
Characteristics This is a rabbit polyclonal antibody against C19orf62. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C19orf62
Background The exact function of C19orf62 remains unknown.
Molecular Weight 36 kDa
Gene ID 29086
NCBI Accession NM_014173, NP_054892
UniProt Q9NWV8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 329 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-BRISC and BRCA1 A Complex Member 1 (BABAM1) (N-Term) antibody WB Suggested Anti-C19orf62 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Validation Images
back to top