BRISC and BRCA1 A Complex Member 1 (BABAM1) antibody

Antigen: BRISC and BRCA1 A Complex Member 1 (BABAM1)

Synonyms: NBA1, HSPC142, MERIT40, FLJ20571, Merit40, MGC94542, merit40, MGC84305, nba1, C19orf62, MGC139524, C7H19orf62, DKFZp468C208

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN503618

Additional Information

Alternative name: MERIT40

Gene ID: C19orf62

UniProt: Q9NWV8

Immunogen: The immunogen for anti-C19orf62 antibody: synthetic peptide directed towards the N terminal of human C19orf62

Sequence: DRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQV PPPAPEVQIR

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-C19orf62 antibody concentration is 1 mg/ml.

Description: The exact function of C19orf62 remains unknown.

Characteristics: Antigen Size: 329 amino acids

Molecular Weight: 36kDa

Application Details

Application Notes: WB Suggested Anti-C19orf62 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-C19orf62 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate

Publications

Product: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).