Inositol-Tetrakisphosphate 1-Kinase (ITPK1) antibody

Antigen: Inositol-Tetrakisphosphate 1-Kinase (ITPK1)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN503620

Additional Information

Alternative name: ITPK1

Gene ID: ITPK1

UniProt: Q13572

Immunogen: The immunogen for anti-ITPK1 antibody: synthetic peptide directed towards the middle region of human ITPK1

Sequence: NAIQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNF SAGTSDRESI

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ITPK1 antibody concentration is 1 mg/ml.

Description: ITPK1 is the kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3. It may also act as an isomerase that interconverts the inositol tetraphosphate isomers Ins(1,3,4,5)P4 and Ins(1,3,4,6)P4 in the presence of A

Characteristics: Antigen Size: 414 amino acids

Molecular Weight: 45kDa

Application Details

Application Notes: WB Suggested Anti-ITPK1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Spleen.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling

Restrictions: For Research Use only

Images

WB Suggested Anti-ITPK1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Spleen

Publications

Product: Humphray, Oliver, Hunt et al.: "DNA sequence and analysis of human chromosome 9." in: Nature, Vol. 429, Issue 6990, pp. 369-74, 2004 (PubMed).