NODAL Modulator 1 (NOMO1) antibody

Antigen: NODAL Modulator 1 (NOMO1)

Synonyms: PM5, Nomo, pM5, MGC37454, MGC37848, D7Ertd156e, RGD1305240, NOMO1, DKFZP459L1733

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus), Xenopus laevis

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN503623

Additional Information

Alternative name: NOMO1

Gene ID: NOMO1

UniProt: P69849

Immunogen: The immunogen for anti-NOMO1 antibody: synthetic peptide directed towards the C terminal of human NOMO1

Sequence: QDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQG VRALGQAASD

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-NOMO1 antibody concentration is 1 mg/ml.

Description: NOMO1 was originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE). This gene encodes a protein originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE).

Characteristics: Antigen Size: 1222 amino acids

Molecular Weight: 134kDa

Application Details

Application Notes: WB Suggested Anti-NOMO1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Embryogenesis

Restrictions: For Research Use only

Images

WB Suggested Anti-NOMO1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate

Publications

Product: Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).