NOMO1 antibody (N-Term)

Catalog No. ABIN633863

Product Details anti-NOMO1 Antibody

Target: NOMO1 (NODAL Modulator 1 (NOMO1))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NOMO1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NOMO1 antibody was raised against the N terminal of NOMO1

Purification: Affinity purified

Immunogen: NOMO1 antibody was raised using the N terminal of NOMO1 corresponding to a region with amino acids DGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLADIIATGFSVC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NOMO1 Blocking Peptide, catalog no. 33R-1965, is also available for use as a blocking control in assays to test for specificity of this NOMO1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOMO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NOMO1

Target: NOMO1 (NODAL Modulator 1 (NOMO1))

Alternative Name: NOMO1 (NOMO1 Products)

Background: NOMO1 was originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE).

Molecular Weight: 134 kDa (MW of target protein)