Retinoic Acid Induced 14 (RAI14) antibody

Antigen: Retinoic Acid Induced 14 (RAI14)

Synonyms: RAI13, NORPEG, KIAA1334, DKFZp564G013, Norpeg, mKIAA1334, Ankycorbin, 1700008J19Rik, 1700020L11Rik, RAI14

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN503672

Additional Information

Alternative name: Ankycorbin / RAI14

Gene ID: RAI14

UniProt: Q9P0K7

Immunogen: The immunogen for anti-RAI14 antibody: synthetic peptide directed towards the middle region of human RAI14

Sequence: ELSQLYKEAQAELEDYRKRKSLEDVTAEYIHKAEHEKLMQ LTNVSRAKAE

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-RAI14 antibody concentration is 1 mg/ml.

Description: RAI14 contains 7 ANK repeats. The function of RAI14 remains unknown.

Characteristics: Antigen Size: 980 amino acids

Molecular Weight: 110kDa

Application Details

Application Notes: WB Suggested Anti-RAI14 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: COLO205 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-RAI14 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: COLO205 cell lysate

Publications

Product: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).