Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Glutathione S-Transferase kappa 1 (GSTK1) antibody

Antigen

Glutathione S-Transferase kappa 1 (GSTK1)

Synonyms GST, GST13, GSTK1-1, GST13-13, DsbA-L, AW260476, 0610025I19Rik, GSTkappa, MGC64544, gst13-13, GSTK1, gstk1, DKFZp459M1330
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Dog (Canine), Human

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN503686
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name GSTK1
Gene ID GSTK1
UniProt Q9Y2Q3
Immunogen The immunogen for anti-GSTK1 antibody: synthetic peptide directed towards the N terminal of human GSTK1
Sequence NLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRH HLQIPIHFPK
Cross-Reactivity Dog (Canine), Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-GSTK1 antibody concentration is 1 mg/ml.
Description GSTK1 is a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. GSTK1 is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells.
Characteristics Antigen Size: 226 amino acids
Molecular Weight 25kDa

Application Details

Application Notes WB Suggested Anti-GSTK1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives

Alternatives for antigen "Glutathione S-Transferase kappa 1 (GSTK1)", type "Antibodies"
Hosts Rabbit (19)
Reactivities Human (16), Mouse (Murine) (8), Rat (Rattus) (4), Cat (Feline) (1), Chicken (1), Cow (Bovine) (1), Dog (Canine) (1)
Applications Western Blotting (WB) (19), Immunohistochemistry (IHC) (10), ELISA (6), Flow Cytometry (FACS) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoprecipitation (IP) (3), Immunocytochemistry (ICC) (2), Immunofluorescence (IF) (1), Immunohistochemistry (Frozen Sections) (IHC (fro)) (1)
Epitopes Center (2), Internal Region (1), Internal Region,AA 99-128 (1), Middle Region (1), N-Term (1)