Family with Sequence Similarity 175, Member B (FAM175B) antibody

Antigen: Family with Sequence Similarity 175, Member B (FAM175B)

Synonyms: ABRO1, FLJ22338, KIAA0157, Abro1, AA589499, AI853413, C430003P19Rik, RGD1308918, abro1, MGC83343

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN503696

Additional Information

Alternative name: FAM175B

Gene ID: KIAA0157

UniProt: Q15018

Immunogen: The immunogen for anti-KIAA0157 antibody: synthetic peptide directed towards the middle region of human KIAA0157

Sequence: FAAEGRSTLGDAEASDPPPPYSDFHPNNQESTLSHSRMER SVFMPRPQAV

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-KIAA0157 antibody concentration is 1 mg/ml.

Description: KIAA0157 is the component of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin. It may act as a central scaffold protein that assembles the various components of the BRISC complex.

Characteristics: Antigen Size: 415 amino acids

Molecular Weight: 47kDa

Application Details

Application Notes: WB Suggested Anti-KIAA0157 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-KIAA0157 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

Publications

Product: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).