LysM, Putative Peptidoglycan-Binding, Domain Containing 2 (LYSMD2) antibody

Antigen: LysM, Putative Peptidoglycan-Binding, Domain Containing 2 (LYSMD2)

Synonyms: AV033872, AW538442, 2210402C18Rik, MGC35274, DKFZp686I2243, RGD1304585, zgc:91941, MGC108236

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Chicken, Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN503716

Additional Information

Alternative name: LYSMD2

Gene ID: LYSMD2

UniProt: Q8IV50

Immunogen: The immunogen for anti-LYSMD2 antibody: synthetic peptide directed towards the middle region of human LYSMD2

Sequence: VEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLK KTLNIPVISE

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-LYSMD2 antibody concentration is 1 mg/ml.

Description: The specific function of the protein remains unknown.

Characteristics: Antigen Size: 215 amino acids

Molecular Weight: 23kDa

Application Details

Application Notes: WB Suggested Anti-LYSMD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-LYSMD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

Publications

Product: Rush, Moritz, Lee et al.: "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." in: Nature biotechnology, Vol. 23, Issue 1, pp. 94-101, 2005 (PubMed).