Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503722

Family with Sequence Similarity 217, Member A (FAM217A) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C6orf146, 1700026J04Rik
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503722
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C6orf146 antibody: synthetic peptide directed towards the middle region of human C6orf146
Sequence ETLPAPNWNLKHGNSSVEENFTDESDLSENEKTNDTLLSY FKKVDLNLKP
Predicted Reactivity Bovine : 92%, Dog : 92%, Rabbit : 92%, Guinea pig : 85%
Characteristics This is a rabbit polyclonal antibody against C6orf146. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C6orf146
Background The specific function of C6orf146 is not yet known.
Molecular Weight 57kDa
Gene ID 222826
NCBI Accession NP_775834, NM_173563
UniProt Q8IXS0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C6orf146 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Mungall, Palmer, Sims et al.: "The DNA sequence and analysis of human chromosome 6." in: Nature, Vol. 425, Issue 6960, pp. 805-11, 2003 (PubMed).

Alternatives for antigen "Family with Sequence Similarity 217, Member A (FAM217A)", type "Antibodies"
Hosts (14)
Reactivities (13)
Applications (10), (5), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1)
Beacon