Did you know that you can buy products from over 140 different suppliers from us?

Family with Sequence Similarity 217, Member A (FAM217A) (Middle Region) antibody

Details for Product No. ABIN503722
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C6orf146, 1700026J04Rik
Epitope
Middle Region
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(13)
Host
Rabbit
(14)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (5), (3), (3)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503722
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C6orf146
Sequence ETLPAPNWNLKHGNSSVEENFTDESDLSENEKTNDTLLSY FKKVDLNLKP
Predicted Reactivity Bovine : 92 %, Dog : 92 %, Rabbit : 92 %, Guinea pig : 82 %
Characteristics This is a rabbit polyclonal antibody against C6orf146. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C6orf146
Background The specific function of C6orf146 is not yet known.
Molecular Weight 57 kDa
Gene ID 222826
NCBI Accession NM_173563, NP_775834
UniProt Q8IXS0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 508 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Family with Sequence Similarity 217, Member A (FAM217A) (Middle Region) antibody WB Suggested Anti-C6orf146 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
Background publications Mungall, Palmer, Sims et al.: "The DNA sequence and analysis of human chromosome 6." in: Nature, Vol. 425, Issue 6960, pp. 805-11, 2003 (PubMed).

Hosts (14)
Reactivities (13)
Applications (10), (5), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503722
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top