Family with Sequence Similarity 217, Member A (FAM217A) antibody

Antigen: Family with Sequence Similarity 217, Member A (FAM217A)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN503722

Additional Information

Alternative name: C6orf146

Gene ID: C6orf146

UniProt: Q8IXS0

Immunogen: The immunogen for anti-C6orf146 antibody: synthetic peptide directed towards the middle region of human C6orf146

Sequence: ETLPAPNWNLKHGNSSVEENFTDESDLSENEKTNDTLLSY FKKVDLNLKP

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-C6orf146 antibody concentration is 1 mg/ml.

Description: The specific function of C6orf146 is not yet known.

Characteristics: Antigen Size: 508 amino acids

Molecular Weight: 57kDa

Application Details

Application Notes: WB Suggested Anti-C6orf146 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-C6orf146 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate

Publications

Product: Mungall, Palmer, Sims et al.: "The DNA sequence and analysis of human chromosome 6." in: Nature, Vol. 425, Issue 6960, pp. 805-11, 2003 (PubMed).