Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Family with Sequence Similarity 98, Member B (FAM98B) antibody

Antigen

Family with Sequence Similarity 98, Member B (FAM98B)

Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN503726
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name FAM98B
Gene ID FAM98B
UniProt A8MUW5
Immunogen The immunogen for anti-FAM98B antibody: synthetic peptide directed towards the N terminal of human FAM98B
Sequence LTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGR DDLESFQLEI
Cross-Reactivity Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-FAM98B antibody concentration is 1 mg/ml.
Description The specific function of FAM98B is not yet known.
Characteristics Antigen Size: 433 amino acids
Molecular Weight 45kDa

Application Details

Application Notes WB Suggested Anti-FAM98B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Spleen.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Tsuritani, Irie, Yamashita et al.: "Distinct class of putative "non-conserved" promoters in humans: comparative studies of alternative promoters of human and mouse genes." in: Genome research, Vol. 17, Issue 7, pp. 1005-14, 2007 (PubMed).

Alternatives

Alternatives for antigen "Family with Sequence Similarity 98, Member B (FAM98B)", type "Antibodies"
Hosts Rabbit (24)
Reactivities Human (22), Mouse (Murine) (18), Rat (Rattus) (18), Dog (Canine) (1)
Applications Immunofluorescence (IF) (14), Western Blotting (WB) (9), ELISA (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Flow Cytometry (FACS) (1), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (2), N-Term (2)