Did you know that you can buy products from over 140 different suppliers from us?

Chromosome 17 Open Reading Frame78 (C17orf78) (Middle Region) antibody

Details for Product No. ABIN503729
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
Middle Region
(1)
Reactivity
Human
(14)
Host
Rabbit
(14), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (6), (3), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503729
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C17orf78
Sequence LGARKLCQCQWLWRWQKKGGQPPGTAESKPDSQPQKVGQD AANSSNPKKA
Predicted Reactivity Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against C17orf78. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C17orf78
Background The exact function of the protein encoded by this gene is not known.
Molecular Weight 30 kDa
Gene ID 284099
NCBI Accession NM_173625, NP_775896
UniProt Q8N4C9
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 275 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 17 Open Reading Frame78 (C17orf78) (Middle Region) antibody WB Suggested Anti-C17orf78 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Hosts (14), (1)
Reactivities (14)
Applications (10), (6), (3), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503729
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top