Taperin (TPRN) antibody

Antigen: Taperin (TPRN)

Synonyms: C87750, MGC107193, C430004E15Rik, RP23-132N23.15

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN503735

Additional Information

Alternative name: Taperin

Gene ID: C9orf75

Immunogen: The immunogen for anti-C9orf75 antibody: synthetic peptide directed towards the middle region of human C9orf75

Sequence: PPFLPAASEEAEPAEGLRVPGLAKNSREYVRPGLPVTFID EVDSEEAPQA

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-C9orf75 antibody concentration is 1 mg/ml.

Description: The specific function of C9orf75 is not yet known.

Characteristics: Antigen Size: 650 amino acids

Molecular Weight: 72kDa

Application Details

Application Notes: WB Suggested Anti-C9orf75 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human heart.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-C9orf75 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human heart

Publications

Product: Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).