Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503738

PDZ Domain Containing 9 (PDZD9) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms LRRGT00105, C16orf65, 4930408O21Rik, C25H16orf65
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503738
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C16orf65 antibody: synthetic peptide directed towards the middle region of human C16orf65
Sequence TSTPKKIELAKDESFTSSDDNENVDLDKRLQYYRYPWSTV HHPARRPISI
Predicted Reactivity Human :100%,   Crab-eating macaque :100%,   Dog :76%,  
Characteristics This is a rabbit polyclonal antibody against C16orf65. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C16orf65
Background The specific function of the protein remains unknown.
Molecular Weight 23kDa
Gene ID 255762
NCBI Accession NP_776167, NM_173806
UniProt Q8IXQ8
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C16orf65 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Martin, Han, Gordon et al.: "The sequence and analysis of duplication-rich human chromosome 16." in: Nature, Vol. 432, Issue 7020, pp. 988-94, 2004 (PubMed).

Alternatives for antigen "PDZ Domain Containing 9 (PDZD9)", type "Antibodies"
Hosts (14), (1)
Reactivities (14), (12), (12), (12), (12)
Applications (10), (6), (3), (3), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1)
Beacon