Ubiquitin Specific Peptidase 12 (USP12) antibody

Antigen: Ubiquitin Specific Peptidase 12 (USP12)

Synonyms: UBH1, USP12L1, USP12P1, USP12, MGC140148, hapln3, usp12, sb:eu882, MGC136837, wu:fi09d12

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Zebrafish, Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN503760

Additional Information

Alternative name: USP12

Gene ID: USP12

UniProt: O75317

Immunogen: The immunogen for anti-USP12 antibody: synthetic peptide directed towards the middle region of human USP12

Sequence: ITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQ EKQNGRLPNG

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-USP12 antibody concentration is 1 mg/ml.

Description: USP12 is a deubiquitinating enzyme. USP12 has almost no deubiquitinating activity by itself and requires the interaction with WDR48 to have a high activity. USP12 is not involved in deubiquitination of monoubiquitinated FANCD2.

Characteristics: Antigen Size: 370 amino acids

Molecular Weight: 43kDa

Application Details

Application Notes: WB Suggested Anti-USP12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Proteolysis / Ubiquitin

Restrictions: For Research Use only

Images

WB Suggested Anti-USP12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Placenta

Publications

Product: Dunham, Matthews, Burton et al.: "The DNA sequence and analysis of human chromosome 13." in: Nature, Vol. 428, Issue 6982, pp. 522-8, 2004 (PubMed).