Retinal Degeneration 3 (RD3) (N-Term) antibody

Details for Product No. ABIN503773
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms 3322402L07Rik, rd-3, rd3, C1orf36, LCA12
Epitope
N-Term
(1)
Reactivity
Human
(2)
Host
Rabbit
(2), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(3), (1)
Pubmed 1 reference available
Catalog no. ABIN503773
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human RD3
Sequence GQMREAERQQRERSNAVRKVCTGVDYSWLASTPRSTYDLS PIERLQLEDV
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against RD3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RD3
Background RD3 is preferentially expressed in retina.Defects in RD3 are the cause of Leber congenital amaurosis type 12 (LCA12).
Molecular Weight 23 kDa
Gene ID 343035
NCBI Accession NM_183059, NP_898882
UniProt Q7Z3Z2
Research Area Neurology
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 195 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Retinal Degeneration 3 (RD3) (N-Term) antibody WB Suggested Anti-RD3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain
Background publications Friedman, Chang, Kannabiran et al.: "Premature truncation of a novel protein, RD3, exhibiting subnuclear localization is associated with retinal degeneration." in: American journal of human genetics, Vol. 79, Issue 6, pp. 1059-70, 2006 (PubMed).

Hosts (2), (1)
Reactivities (2)
Applications (3), (1)
Epitopes (1)
back to top