Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503773

Retinal Degeneration 3 (RD3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 3322402L07Rik, rd-3, rd3, C1orf36, LCA12
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503773
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RD3 antibody: synthetic peptide directed towards the N terminal of human RD3
Sequence GQMREAERQQRERSNAVRKVCTGVDYSWLASTPRSTYDLS PIERLQLEDV
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against RD3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RD3
Background RD3 is preferentially expressed in retina.Defects in RD3 are the cause of Leber congenital amaurosis type 12 (LCA12).
Molecular Weight 23kDa
Gene ID 343035
NCBI Accession NP_898882, NM_183059
UniProt Q7Z3Z2
Research Area Neurology
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RD3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Friedman, Chang, Kannabiran et al.: "Premature truncation of a novel protein, RD3, exhibiting subnuclear localization is associated with retinal degeneration." in: American journal of human genetics, Vol. 79, Issue 6, pp. 1059-70, 2006 (PubMed).

Alternatives for antigen "Retinal Degeneration 3 (RD3)", type "Antibodies"
Hosts (2)
Reactivities (1)
Applications (2)
Epitopes (1)
Beacon