Retinal Degeneration 3 (RD3) antibody

Antigen: Retinal Degeneration 3 (RD3)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN503773

Additional Information

Alternative name: RD3

Gene ID: RD3

UniProt: Q7Z3Z2

Immunogen: The immunogen for anti-RD3 antibody: synthetic peptide directed towards the N terminal of human RD3

Sequence: GQMREAERQQRERSNAVRKVCTGVDYSWLASTPRSTYDLS PIERLQLEDV

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-RD3 antibody concentration is 1 mg/ml.

Description: RD3 is preferentially expressed in retina.Defects in RD3 are the cause of Leber congenital amaurosis type 12 (LCA12).

Characteristics: Antigen Size: 195 amino acids

Molecular Weight: 23kDa

Application Details

Application Notes: WB Suggested Anti-RD3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Neurology

Restrictions: For Research Use only

Images

WB Suggested Anti-RD3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain

Publications

Product: Friedman, Chang, Kannabiran et al.: "Premature truncation of a novel protein, RD3, exhibiting subnuclear localization is associated with retinal degeneration." in: American journal of human genetics, Vol. 79, Issue 6, pp. 1059-70, 2006 (PubMed).