Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503781

Tumor Protein P63 Regulated 1 (TPRG1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FAM79B, 5430420C16Rik, Tprg1, Tprg, Svap30, RGD1306226, MGC68514, MGC162933, zgc:162933
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN503781
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FAM79B antibody: synthetic peptide directed towards the N terminal of human FAM79B
Sequence DPMPRQISRQSSVTESTLYPNPYHQPYISRKYFATRPGAI ETAMEDLKGH
Predicted Reactivity Human :100%,   Dog :92%,  
Characteristics This is a rabbit polyclonal antibody against FAM79B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FAM79B
Background The specific function of this protein remains unknown.
Molecular Weight 31kDa
Gene ID 285386
NCBI Accession NP_940887, NM_198485
UniProt Q6ZUI0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FAM79B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Background publications Gunnarsdóttir, Li, Bauchet et al.: "High-throughput sequencing of complete human mtDNA genomes from the Philippines." in: Genome research, Vol. 21, Issue 1, pp. 1-11, 2011 (PubMed).

Alternatives for antigen "Tumor Protein P63 Regulated 1 (TPRG1)", type "Antibodies"
Hosts (6)
Reactivities (5)
Applications (6), (1), (1)
Epitopes (2), (2)
Beacon