Immediate Early Response 5-Like (IER5L) (Middle Region) antibody

Details for Product No. ABIN503812
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2610524G09Rik, bA247A12.2, fe50b07, zgc:73321, zgc:77455, wu:fe50b07, MGC75980
Epitope
Middle Region
(2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(2), (2)
Host
Rabbit
(4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(4)
Pubmed 1 reference available
Catalog no. ABIN503812
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human IER5L
Sequence SNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALAS LGAWTRAIVA
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Guinea pig : 80 %
Characteristics This is a rabbit polyclonal antibody against IER5L. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name IER5L
Background The specific function of this protein remains unknown.
Molecular Weight 42 kDa
Gene ID 389792
NCBI Accession NM_203434, NP_982258
UniProt Q5T953
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 404 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Immediate Early Response 5-Like (IER5L) (Middle Region) antibody WB Suggested Anti-IER5L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: NCI-H226 cell lysate
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Hosts (4)
Reactivities (2), (2)
Applications (4)
Epitopes (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top