Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503812

Immediate Early Response 5-Like (IER5L) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2610524G09Rik, bA247A12.2, fe50b07, zgc:73321, zgc:77455, wu:fe50b07, MGC75980
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503812
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-IER5L antibody: synthetic peptide directed towards the middle region of human IER5L
Sequence SNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALAS LGAWTRAIVA
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Guinea pig : 85%
Characteristics This is a rabbit polyclonal antibody against IER5L. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name IER5L
Background The specific function of this protein remains unknown.
Molecular Weight 42kDa
Gene ID 389792
NCBI Accession NP_982258, NM_203434
UniProt Q5T953
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-IER5L antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Alternatives for antigen "Immediate Early Response 5-Like (IER5L)", type "Antibodies"
Hosts (4)
Reactivities (2), (2)
Applications (4)
Epitopes (2), (1)
Beacon