IER5L antibody (Middle Region)

Catalog No. ABIN632857

Product Details anti-IER5L Antibody

Target: IER5L (Immediate Early Response 5-Like (IER5L))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IER5L antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IER5 L antibody was raised against the middle region of IER5

Purification: Affinity purified

Immunogen: IER5 L antibody was raised using the middle region of IER5 corresponding to a region with amino acids SNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IER5L Blocking Peptide, catalog no. 33R-8655, is also available for use as a blocking control in assays to test for specificity of this IER5L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IER0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IER5L

Target: IER5L (Immediate Early Response 5-Like (IER5L))

Alternative Name: IER5L (IER5L Products)

Synonyms: 2610524G09Rik antibody, fe50b07 antibody, zgc:73321 antibody, zgc:77455 antibody, wu:fe50b07 antibody, bA247A12.2 antibody, MGC75980 antibody, immediate early response 5-like antibody, immediate early response 5 like antibody, immediate early response 5-like S homeolog antibody, immediate early response 2 antibody, Ier5l antibody, ier5l antibody, IER5L antibody, ier5l.S antibody, IER2 antibody

Background: The function of IER5 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 42 kDa (MW of target protein)