Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 2 (RPS6KA2) antibody

Antigen

Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 2 (RPS6KA2)
Synonyms RSK, HU-2, RSK3, p90-RSK3, pp90RSK3, MAPKAPK1C, S6K-alpha, S6K-alpha2
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN503865
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 2 (RPS6KA2) antibody

Additional Information
Application Details Publications Images Alternatives back to top

Alternative name RPS6KA2 / RSK3
Gene ID RPS6KA2
UniProt Q15349
Immunogen The immunogen for anti-RPS6KA2 antibody: synthetic peptide directed towards the middle region of human RPS6KA2
Sequence LSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQR RGMKRLTSTR
Cross-Reactivity Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-RPS6KA2 antibody concentration is 1 mg/ml.
Description RPS6KA2 is a serine/threonine kinase that may play a role in mediating the growth-factor and stress induced activation of the transcription factor CREB.This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Characteristics Antigen Size: 733 amino acids
Molecular Weight 81kDa

Application Details
Publications Images Alternatives back to top

Application Notes WB Suggested Anti-RPS6KA2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives back to top

Product Wissing, Jänsch, Nimtz et al.: "Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry." in: Molecular & cellular proteomics : MCP, Vol. 6, Issue 3, pp. 537-47, 2007 (PubMed).

Alternatives
Application Details Publications Images back to top

Alternatives for antigen "Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 2 (RPS6KA2)", type "Antibodies"
Hosts Rabbit (49), Mouse (3)
Reactivities Human (49), Mouse (Murine) (40), Rat (Rattus) (33)
Applications Immunofluorescence (IF) (28), Western Blotting (WB) (23), ELISA (17), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (6), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (IHC) (3), Immunoprecipitation (IP) (2), Immunocytochemistry (ICC) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (3), Alexa Fluor 488 (3), Alexa Fluor 555 (3), Alexa Fluor 647 (3), PE,Cy5.5 (3), Alexa Flour 488 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy7 (1)
Epitopes Internal Region (5), pThr356,pThr353 (5), pSer360,pThr356 (4), pThr353,pThr356,Internal Region (3), AA 415-733 (1), Asp659 (1), C-Term (1), Pro709 (1), pThr573 (1)