Stratifin (SFN) antibody

Antigen: Stratifin (SFN)

Synonyms: YWHAS, Er, Mme1, Ywhas, LOC408037, LOC100220844

Clonality: Polyclonal

Host: Rabbit

Reactivity: Caenorhabditis elegans (C. elegans), Human, Mouse (Murine), Rat (Rattus), Chicken

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN503870

Additional Information

Alternative name: 14-3-3 protein sigma / SFN

Gene ID: RPS15

UniProt: P62841

Immunogen: The immunogen for anti-RPS15 antibody: synthetic peptide directed towards the middle region of human RPS15

Sequence: GVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIG ATHSSRFIPL

Cross-Reactivity: Caenorhabditis elegans (C. elegans), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-RPS15 antibody concentration is 1 mg/ml.

Description: The specific function of this protein remains unknown.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S19P family of ribosomal proteins. It is located in the cytoplasm. This gene has been found to be activated in various tumors, such as insulinomas, esophageal cancers, and colon cancers. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 145 amino acids

Molecular Weight: 17kDa

Application Details

Application Notes: WB Suggested Anti-RPS15 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-RPS15 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver

Publications

Product: Yu, Ji, Doudna et al.: "Mass spectrometric analysis of the human 40S ribosomal subunit: native and HCV IRES-bound complexes." in: Protein science : a publication of the Protein Society, Vol. 14, Issue 6, pp. 1438-46, 2005 (PubMed).